PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Dca25431.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Caryophyllaceae; Caryophylleae; Dianthus
Family FAR1
Protein Properties Length: 258aa    MW: 29328 Da    PI: 5.7633
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Dca25431.1genomeDCAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR123.42e-07741155091
        FAR1  50 kerrtraetrtgCkaklkvkkekdgkwevtkleleHnHelap 91 
                  ++++   tr +Cka ++  +++ g wev +   eHnH+l+p
  Dca25431.1  74 VQQKNALITRSKCKAWIRTLLNEAGLWEVVDHIIEHNHPLTP 115
                 56788899*******************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031016.2E-575115IPR004330FAR1 DNA binding domain
Sequence ? help Back to Top
Protein Sequence    Length: 258 aa     Download sequence    Send to blast
MSNNKTKKPC TITFEIENVI DLEKDASKED VFEGGGEDNP VDKEHDELGV DDNLGDMKGE  60
HGNGSWCGLK GVSVQQKNAL ITRSKCKAWI RTLLNEAGLW EVVDHIIEHN HPLTPPQWQH  120
HHRSERRISE AKGEVIKAIT ETLVAPFVQF RVASAVAGGD TLVGHTKRDH INFVNRLKMR  180
SIEGGDAATL INLMNSRQAE DPGFFFRVQF DEDGRLCNLF WRDSMMKEDY LLYHDVVIFD  240
TTYRTNRYNL ICGAFVDI
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010665808.18e-68PREDICTED: protein FAR1-RELATED SEQUENCE 5-like
RefseqXP_010681849.18e-68PREDICTED: protein FAR1-RELATED SEQUENCE 5-like
RefseqXP_010695927.11e-69PREDICTED: protein FAR1-RELATED SEQUENCE 5-like
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38180.13e-28FAR1-related sequence 5